Pathogenicity and amino acid sequences of hemagglutinin cleavage site and neuraminidase stalk of differently passaged H9N2-avian influenza virus in broilers ()
1. INTRODUCTION
The H9N2 Avian Influenza (AI) virus infects a wide variety of wild birds and domestic poultry in many parts of the world [1-4], causing significant economic losses, due to increased mortality and morbidity frequency among broilers, layers and breeders [5]. The circulation of AI viruses among wild birds and poultry resulted in the emergence of pathogenic strains originating from low or mild pathogenic viruses [6,7]. The incomplete cleaning and disinfection of poultry houses and hatcheries result in the persistence of AI viruses in organic premices and waste, leading into its passaging or transmission to the next flock [8]. Mixing birds of different species or ages might lead to the circulation of AI viruses and possible reassortment of such strains [8-10].
The pathogenicity of AI viruses increases upon passaging due to an increase in the adaptation to the host [7,8]. Consequently, the low pathogenic strains, originally failing to replicate efficiently in the host tissues, gradually increase their ability to bind to the specific cell receptors, leading to higher replication efficiency in the host cells [7,8].
There is a meager documentation of the potential of H9N2 viruses in attaining gradual higher pathogenicity, following few amino acid changes that could occur in the Hemagglutinin (HA) protein and/or Neuraminidase (NA) stalk [1,11,12]. It is proven that a substitution of arginine in the place of Serine at the –2 position of the HA connecting peptide can produce a basic motif for highly pathogenic viruses (R-S-S-R) [1,11]. This motif is recognized by the host ubiquitous proteases, enabling them to cleave the HA0 to HA1 and HA2, thus leading to a systemic infection of the host tissues by the virus. There is an indication in literature that the length of the NA stalk could have an impact on the viral AI pathogenicity; it is documented that a deletion of few amino acids from the NA stalk, namely at position 38 - 39 and 63 - 65, can convert the low pathogenic AI (LPAI) to highly pathogenic AI (HPAI) viruses [1,10,12]; however, no literature points at the impact of a.a. substitution in NA stalk, in absence of deletions, on gradual raise of pathogenicity in avians.
A change in AI viruses from a low to high pathogenicity nature results in an increase in chicken mortality percent, from 5% by LPAI infection to 20% - 100% in HPAI infections [5,8,13]; in addition, the frequency of morbidity signs are increased among birds, including a decrease in feed intake, a decrease in weight and egg production, and a higher frequency of huddling, coughing, sneezing, rales, ocular discharge, and swelling of infraorbital sinuses [5,8,14]. This increase in mortality and morbidity frequency is the result of viral dissemination and spreading from the nasal cavity, which is the primary site of infection, to the lower part of the respiratory tract, kidneys, intestines, heart and other visceral organs [5,8,14, 15].
A modification in tissue tropism could lead into a higher pathogenicity and more prominent disease signs. Upon mutation of LPAI to HPAI, such viruses acquire pneumotropism, nephrotropism, neurotropism, enterotropism and even exert tropism toward lymphoid tissues [5,14,15]. The HPAI viruses replicate within epithelial and endothelial cells of the respiratory organs causing major macroscopic or gross lesions such as tracheitis, lung congestion, airsacculitis, and sinusitis; these replicating viruses could spread through the vascular and lymphoid system to visceral organs causing enteritis, nephritis, splenomegaly, vascular and myocardial damage [5,9,14-16]. The frequency of microscopic lesions are also increased, specifically in the respiratory system, causing deciliation and Goblet cells degeneration in the trachea, mucus accumulation and heterophils infiltration in the trachea, lung, and airsacs [5,16,17].
This work studies the impact of the number of viral passages in the respiratory organs of 21-days-old broilers on amino acid sequences of Hemgglutinin 1 (HA1) cleavage site and Neuraminidase (NA) stalk and its relatedness to gradual raise in pathogenicity.
2. MATERIALS AND METHODS
2.1. Original Virus
The original H9N2 strain (P0), used in this study, is a LPAI virus. This virus was isolated from a broiler chicken during an outbreak in a 40,000 flock size [2,4]. Complete typing of H9N2 was concluded at the Central Veterinary Laboratory in Weybridge, UK.
2.2. H9N2 Passaging in Broilers
Ten 21 days-old broilers, of the Ross 308 breed, were intratracheally challenged with the original H9N2 AI virus (P0), at 7 × TCID50/0.5 ml inoculum/bird. Another 10 control birds were left free from any viral challenge. Individual recovery of the H9N2 virus from homogenates of trachea, lung, and airsac of experimental and control birds was attempted in 9-days-old embryos, according to previous procedures [7,18], and as a conclusion of the first passage (P1). The success of recovery of the H9N2 virus in embryos was based on presence of allantoic fluid-hemagglutination (HA) activity against chicken-Red Blood Cell suspension of 1.0%. Allantoic fluids from tracheal inocula, with HA activity, were pooled in equal volume, and was used as an inoculum for a second passage of the H9N2 in another ten 21- days-old broilers (P2), leaving 10 birds as controls. The inoculum used was set also at 7 × TCID50/0.5 ml/bird. The same recovery protocol and third passage (P3) procedure were used, as described above.
2.3. Pathogenicity Assessment
2.3.1. Mortality and Morbidity Assessment
The frequency of mortality and of morbidity signs, including rales, sneezing, swelling of infraorbital sinuses, conjunctivitis, and ocular exudates were observed at 3 days post challenge [19-21] with each of P1, P2, and P3- H9N2 viruses. Experimental and control broilers, corresponding to the challenge with each of the three differently passaged H9N2 viruses, were sacrificed with CO2 at 3 days post the viral incubation period [19,20].
2.3.2. Gross Lesions
Gross lesions resulting from the 3 differently passaged H9N2 in broilers were observed and recorded for each bird namely, the occurrence of tracheitis, airsacculitis, lung congestion, and enteritis. Three respiratory system organs namely, trachea, lung, and right thoracic airsac were each individually removed asceptically, cut into two sections, one fixed in 10% formalin for histopathologic observations, while the second section was used for H9N2 viral isolation and propagation in 9 days-old chicken embryos.
2.3.3. Histopathology
The histopathological studies on collected organs of experimental and control birds included the use of the 10% formalin fixed tissue cuts that were subjected to crosssectioning of 4 μm, followed by H & E staining. The microscopic observation at 1000× included tracheal deciliation, mucosal hypertrophy, Goblet cell degeneration, mucus accumulation, and heterophil infiltration in 4 tracheal cuts/bird within 4 microscopic fields/cut, located at 2, 4, 8, and 10 clock positions. A score of 1 was assigned for each of the following tracheal tissue changes, namely, deciliation, mucosal hypertrophy, Goblet cell degeneration, and mucus accumulation, while a score of 0 was given to the absence of these tracheal changes. The average score of 4 fields/tissue section of 10 birds per group was used in statistical analysis. The same procedure was followed to compare the frequencies of mucus accumulation in lungs and fibroplasia in the right airsac.
The cumulative heterophil count in 12 fields (4 fields/ tissue section of each respiratory organ) was recorded. Microscopic images, magnified 1000×, were taken of all recorded microscopic lesions for documentation.
2.4. Amplification and Sequencing of Specific H9N2 Genome Segments
The amplification and nucleotide sequencing of the HA1- cleavage site and of neuraminidase (NA) stalk of P0, P1, P2, and P3-H9N2 viruses were concluded, according to previous procedures [12,22] and to the manufacturer instructions provided by the Qiagen kits. Briefly, the H9N2-viral RNA was extracted from the allantoic fluids using the QIAamp Viral RNA Mini Kit (Qiagen, Germany). The extracted RNA from all passages was adjusted to 20 µg/50 µl of the reaction mixture. The RNA was amplified by reverse transcription Polymerase Chain Reaction (PCR) using One-Step RT-PCR kit (Qiagen, Germany). The degenerate primers used for PCR amplification, targeting the cleavage site of the HA1 gene sequence, were the forward primer HU1 (5’- TATGGGGCATACAYCAYCC-3’) and the reverse primer HU2c (5’-TCTATGAACCCWGCWATTGCTCC-3’) where Y = C or T and W = A or T [22]. Primers for NA stalk gene amplification were the forward primer NAF (5’- GCAATTGGCTCTGTTTCTCT-3’) and the reverse primer NAR (5’-CTTTGGTCTTCCTCTTATCA-3’) [12]. The resulting DNA amplicons, with an expected length of 486 base pairs for HA1 and 1200 base pairs for NA stalk, were subjected to electrophoresis and visualized in 2% agarose gel using ethidium bromide staining.
The DNA amplicon was excised from the gel and purified with the QIAquick Gel Extraction kit (Qiagen, Germany). The nucleotide sequence of HA1 and NA stalk was determined for P0, P1, P2, and P3 viruses, recovered from each of the three organs of the broiler respiratory system, by using 3100 Avant Genetic AnalyzerABI PRISM (Applied Biosystems, Hitachi), and by the inclusion of the reverse HU2c and NAR primers for HA1 and NA stalk, respectively.
The amino-acid coding by the determined nucleotide sequences were determined and compared among the original (P0) and the differently passaged isolates of H9N2 (P1, P2, and P3), using the program of the NCBI website, known as Basic Local Alignment Search Tool (BLAST v. 2.2.15) (www.ncbi.nlm.nih.gov) [23].
2.5. Statistics
The frequencies of mortality, morbidity signs, gross lesions and embryonic recovery of H9N2 from different respiratory organs of broilers, at 3 days following challenge are compared among control and experimental broiler groups, challenged with differently passaged viruses, using the Chi-Square. The frequency of the microscopic lesions were compared using one way ANOVA and Tukey’s test. Statistical analysis was performed using a Statistical Package for the Social Sciences program version 18 (SPSS Inc, Chicago).
3. RESULTS AND DISCUSSION
3.1. Gradual Raise in Pathogenicity of Differently Passaged H9N2 in Broilers
No mortality was observed among the control birds and those challenged with the differently passaged H9N2 viruses. The morbidity rate remained low (<50%) with viral passaging, indicating that the virus did not acquire the “High Pathogenic” nature, as defined by the OIE, in which mortality should range between 20% to 60% while the morbidity rates rise over 50% [5]. This low pathogenicity was associated with an absence of nasal discharge and occasional occurance of diarrhea in challenged birds. However, viral passaging resulted in higher pathological changes, leading to a significant increase in the frequency of birds showing specific morbidity signs namely swelling of infraorbital sinuses, conjunctivitis, and ocular exudates (Table 1, P < 0.05). Rales and sneezing are two typical signs of Low Pathogenic AI viruses [5,8]; actually, the two signs were seen in high frequency in birds challenged with P1- H9N2 (10 birds/10 and 8 birds/10 showing sneezing and rales, respectively), and birds challenged with P2-H9N2 (10 birds/10 showing sneezing and rales), and P3-H9N2 birds (8 birds/10 and 10 birds/10 showing sneezing and
Table 1. Frequency of broilers with specific morbidity signs at three days post H9N2 challenge.
Table 2. Frequency of broilers with specific gross lesions at three days post H9N2 challenge.
rales, respectively) (Table 1). It is worth noting that the frequency of morbidity signs in control-unchallenged birds, included in the P1, P2, and P3 trials, was almost absent; this result provided an indication of the success of precautions followed in the isolation pens used for rearing the different groups.
The frequency of birds showing specific gross lesions following challenges with P1, P2, and P3-H9N2 is presented in Table 2. Following viral passaging, the H9N2 viruses had their significant cytopathic effects in the right thoracic and abdominal airsacs in P2 and P3- challenged birds as compared to P1-challenged birds (P < 0.05). There was a trend of an increase in the frequency of birds showing left airsacculitis following viral passaging (6/10, 7/10, and 9/10 in P1, P2, and P3-challenged birds respectively, P > 0.05). These results indicate the ability of H9N2 passaging to induce higher pathological changes in the host tissues, specifically airsacs. This viral adaptation to the lower respiratory tract tissue was further reflected by an abrupt increase in the frequency of birds showing lung congestion [(9/10 in P2 and P3 versus 0/10 in P1 challenged birds) (P < 0.05)]. The H9N2 passaging resulted in a significant increase in frequency of challenged birds showing enteritis in the P3 compared to P1-birds (P < 0.05). The dissemination and adaptation of H9N2 to the digestive tract cells indicates that the virus acquired new tissue tropism towards enteric cells that have a mixture of furin-like and trypsin-like proteases [1,8]. The LPAI-H9N2 virus seems to have high ability to infect the tracheal cells resulting in a high frequency of challenged birds that showed tracheitis (6/10 in P1, and P2 challenged birds, and 7/10 in P3 challenged birds, P > 0.05, Table 2). Such results could be due to the presence of trypsine-like enzyme in the epithelial cells of the trachea which might cleave the HA0 of H9N2 viruses to HA1 and HA2, rendering the virus infective [8]. The viral passaging did not affect the pericardium, since no pericarditis was observed in all of the experimental birds. It is worth noting that only the HPAI viruses are able to induce cardiovascular damage following viraemia, oedema and congestion of the cardiac integuments [5,14,16]; the pericarditis can exist in mixed infection of AI viruses with respiratory pathogens that enhance the H9N2 dissemination and infection in heart tissues, including co-infection with Mycoplasma gallisepticum [19,20], Haemophilus paragallinarum and Staphylococcus aureus [21]. Moreover, the absence of pericarditis could have helped the challenged birds to survive fully (100%) and to manifest a morbidity lower than the 50% frequency (Table 1).
Histopathologic changes in respiratory organs of challenged birds are presented in Table 3. There was an insignificant difference in the frequency of birds showing deciliation, Goblet cells degeneration, and mucus accumulation (Figure 1) following challenges with differently passaged H9N2.
The high frequency of challenged birds showing tracheitis (Table 2) could be a result of the efficient viral dissemination in an infection site that is rich in trypsinlike proteases. These enzymes enable the virus to replicate easily in the epithelial tracheal cells causing deciliation, destruction of Goblet cells through cytolysis and
Table 3. Histopathologic lesions in three respiratory organs of broilers at 3 days post challenge with differently passaged H9N2 virus.
Figure 1. A microscope slide photograph of deciliation (arrow), Goblet cells degeneration (dashed arrow), and mucus accumulation (dotted arrow) in tracheas of P3-challenged birds (left image) versus normal ciliation (dashed oval), presence of intact Goblet cells (oval), and absence of mucus accumulation in tracheas of control birds (right image). (H & E stain, 1000× magnification).
Figure 2. A microscope slide photograph of heterophils infiltration (arrows) in tracheal tissues of P3-challenged birds (left image) versus absence of heterophils (oval) in tracheas of control birds (right image). (H & E stain, 1000× magnification).
release of virions [14,15,17,24], and mucus accumulation in necrotic areas [14,15,17]. There was significant increase of tracheal heterophils following viral passaging from 15 heterophils/tissue section in P1, to 21, and 23 heterophils/tissue section in P2, and P3, respectively (Table 3, Figure 2, P < 0.05). Previous workers related the increase of heterophil counts to the accumulation of Reactive Oxygen Species (ROS) following necrosis of the epithelial and parenchymal cells of the trachea, leading to subsequent inflammation [25]. Moreover, the increased heterophil numbers in the trachea might enhance viral dissemination, since AI viruses are proven to use the immune cells, namely heterophils and macrophages, as vehicles to reach to different host body tissues [5,8]. No significant differences were observed in the frequency of mucus accumulation in the lung airducts or in the fibroplasia of the right airsac among challenged birds (P > 0.05). However, these observations were significantly different between challenged and control birds, as presented in Table 3 and the documentation of images in Figures 3 and 4.
These findings are inducive for future investigations targetting higher number of passages of H9N2, which might enable these viruses to infect the lower respiratory tract parenchyma, including the lungs and airsacs. It is worth noting that the low heterophils infiltration in these two organs is indicative of the low infectivity of the passaged H9N2 viruses, since the heteropils are known to be present in respiratory tissues in advanced stages of inflammation and infection [26,27]. The H9N2 recovery
Figure 3. A microscope slide photograph showing few heterophils infiltration in the lung parenchyma (arrow) and mucus accumulation in the lung airducts (dashed arrow) of P3-challenged birds (left image) versus absence of heterophils or mucus accumulation in the lungs of control birds (right image). (H & E stain, 1000× magnification).
Figure 4. A microscope slide photograph showing fibroplasia (dashed arrow) and few heterophils infiltration in the airsac (arrow) of P3-challenged birds (left image) versus absence of fibroplasia or heterophils infiltration in the airsac of control birds (right image). (H & E stain, 1000× magnification).
Table 4. Recovery* frequency of differently passaged H9N2 viruses from different respiratory organs.
from the three examined organs of the respiratory system was similarly high in birds challenged with the differently passaged viruses (Table 4, P > 0.05). These results indicate the nature of the extended dissemination of H9N2 virus in the whole respiratory system. However, a low pathologic effect by the H9N2 virus was observed in the lungs and airsac of the P0-challenged birds, as reflected in the observed gross and microscopic lesions, revealing the significant impact of passaging on gradual raise of pathogenicity in specific respiratory organs, regardless of the similar frequency of recovery of such viruses from the examined tissues.
3.2. Cleavage Site of HA1 and Neuraminidase Stalk Sequences in H9N2
RT-PCR amplification of a part of HA1 and NA stalk of the extracted RNA of H9N2 recovered from allantoic fluid of eggs that were inoculated with the differently passaged broiler-tracheal isolates, are presented in Figures 5 and 6. These results confirm the presence of positive H9N2 viruses with a 486 bp length amplicon for HA1 and a 1200 bp length amplicon for NA stalk. The amino acid sequence concluded from a part of HA1 nucleotide sequencing, ranging between position 265 to 338 was GHILSGGSHGRILKTDLKSGNCVVQCQTE KGGLNSTLPFHNISKYAFGTCPKYIRVKSLKLAVG MRNVPARSSR, a typical sequence present in P1, P2, and P3-H9N2 viruses. The presence of the above conserved HA0 cleavage site motif PARSSR, with two basic Arginine amino acids, renders this part of genome not correlating with the higher frequency of morbidity signs, gross and microscopic lesions observed with more passaging of the H9N2. Similar results were obtained in previous literature, reporting varying pathogenicity of H9N2 with a stable-conserved PARSSR cleavage site motif in different outbreaks of Asian and Middle eastern countries [3,7]. The number of HA1 glycosilation sites was also stable in the differently passaged H9N2 namely,
Figure 5. PCR amplification of the HA1 gene of the experimental viruses. P0 = original A/chicken/Lebanon1/2004 H9N2 isolate. P1T, P1L, P1A = once passaged H9N2 virus, recovered from trachea, lung, and right airsac of 21-day-old broilers, respectivey. P2T, P2L, P2A = twice passaged H9N2 virus, recovered from trachea, lung, and right airsac of 21-day-old broilers, respectively. P3T, P3L, P3A = three times passaged H9N2 virus, recovered from trachea, lung, and right airsac of 21-day-old broilers, respectively. M = 100 base pair molecular marker. N = negative control.
Figure 6. PCR amplification of the NA stalk gene of the experimental viruses. P0 = original A/chicken/Lebanon1/2004 H9N2 isolate. P1T, P1L, P1A = once passaged H9N2 virus, recovered from trachea, lung, and right airsac of 21-day-old broilers, respectivey. P2T, P2L, P2A = twice passaged H9N2 virus, recovered from trachea, lung, and right airsac of 21-day-old broilers, respectively. P3T, P3L, P3A = three times passaged H9N2 virus, recovered from trachea, lung, and right airsac of 21-day-old broilers, respectively. M = 100 base pair molecular marker. N = negative control.
the NIS and NST at amino acid position 308 and 314, rendering an absence of the correlation between glycosilation sites and the higher frequencies in pathologic effects seen with more passaging. These results disagree with previous reported literature, indicating that a decrease in number of glycosilation sites results in an increase of pathogenicity of H5N1, H7, and H9N2 viruses [1].
The amino acid sequence deducted from the nucleotide sequence of a part of NA stalk (amino acid position from 32 to 104) is presented in Table 5. None of the passaged viruses, and regardless of its respiratory organ source, did show any amino acid deletion at position 38 - 39 and 63 - 65 of the NA stalk. P1 viruses showed an 85 to 97 similarity percentage with the original P0 virus indicating a high mutagenic potential of H9N2 at the NA stalk a.a sequence. The similarity percentage of the P2 to P0 viruses was reduced to 83% - 96%. These a.a changes were observed in two segments of the NA stalk namely from K38 to V51 and from L68 to C78. However, P3 viruses, which were highly adaptable to the broiler respiratory tissues (Tables 2 and 3), showed the least NA amino acid sequence difference to that observed in the original P0 virus. In relation to the NA a.a. sequence of P0 viruses, the P3 viruses, recovered of the broiler tracheas, showed a single substitution of arginine with proline positioned at 46, while the P3 viruses, recovered from lungs and right airsacs, showed an additional substitution of asparagine with lysine positioned at 47. Consequently, the pathogenicity of H9N2 seems to be dependant on a single a.a. substitution of Arginine with Proline positioned at 46 in the a.a sequence of NA stalk. Deletions in the NA stalk of H9N2 positioned at 38 - 39 and 63 - 65 were not detected in this work, unabling the establishment of a relationship between deletions in NA stalk to the observed gradual raise in pathogenicity of H9N2. However, previous work related such deletions to adaptability of this virus to human hosts [1,28]. It is worth noting that a.a deletions at these positions resulted in highly pathogenic H9N2 virus development in ducks, with a reported strain identity known as Dk/HK/Y280/97 [1].
4. CONCLUSIONS
The three-fold serial passaging of H9N2 virus in 21- days-old broilers caused an increase in gross lesions, specifically in the lower respiratory tract and the intestines, and resulted in an increase of heterophil count in tracheal tissues of the challenged birds. However, the three viral passages didn’t convert the LPAI-H9N2 to a HPAIH9N2 virus. This was reflected by the low mortality and morbidity rates observed in birds challenged with P1, P2, and P3 viruses. Future studies should include different inoculation routes, additional viral passaging and coinfections strategies to help in establishing a wider view of the factors affecting the H9N2 pathogenicity in broilers.
The analysis of the amino acid sequence concluded from a part of HA1 nucleotide sequencing between 265 to 338 position revealed a conserved nature among all of the passaged viruses (R-S-S-R), a cleavage site that is present in most Asian and Middle Eastern recovered isolates of H9N2. The presence of such a conserved motif and conserved glycosilation sites in differently passaged H9N2, varying in their pathologic effect, eliminates the concept of relatedness of pathogenicity to HA1 cleavage site and/or glycosilation sites. A future sequence analysis of HA2, which is responsible for viral fusion with the host cell, following neuraminidase activity,
Table 5. Amino acid sequences of a part of the neuraminidase stalk of the differently passaged H9N2 viruses (a.a position 32 - 104).
would be important to understand the role of the total HA protein in the H9N2 pathogenicity.
The neuraminidase stalk showed an a.a sequence variability among the differently passaged viruses. However viruses with different pathologic effects, namely P0 and P3 showed the highest amino acid sequence similarity, with one amino acid substitution. These findings indicate, most likely, the relatedness of a single amino acid substitution of Arginine to serine positioned at 46 in the NA stalk to viral pathogenicity. Moreover, no deletion was observed in a.a position 63 - 65 and 38 - 39 in P2 and P3 viruses, in spite of the higher morbidity, and gross and microscopic lesions to broilers respiratory tissues, caused by these two passaged isolates. Consequently, the pathogenicity of H9N2 seems to be unrelated to deletions in the NA stalk. A detailed study of the potential of a.a. variability in the NA stalk should be investigated in the future, in terms of its relatedness to gradual augmentation of the pathogenicity in H9N2 viruses. The deletions in the NA stalk could be responsible for the adaptation of the H9N2 viruses to different host species, a hypothesis that will be investigated in our future research