High-level secretory expression, purification, and characterization of an anti-human Her II monoclonal antibody, trastuzumab, in the methylotrophic yeast Pichia pastoris ()
1. INTRODUCTION
Recombinant monoclonal antibodies (mAbs) are useful for biological research, diagnostics and therapeutic purposes. In most cases, the host cells for production are mammalian cell lines, such as Chinese ovary cells [1] and NS0 [2]. All approved monoclonal antibodies at present are produced by mammalian cell lines [3]. Since mammalian cell cultures are far more complex and expensive than microbial cell cultures, expression systems with microorganisms have gained importance. However, bacterial systems, such as Esherichia coli, are often not able to modify the product as mammalian cells do.
With their capacity for post-translational modifications and potential to produce large quantities of rather complicated heterologous proteins, yeast production systems are seen as promising substitutes for mammalian cell systems [4,5]. Among several yeast systems, one using Pichia pastoris is increasingly being applied to both research and the production of proteins for diagnostic and therapeutic purposes. Use of its AOX 1-promoter [6], which controls the expression of the enzyme alcohol oxidase, led to the development of methanol-inducible expression systems. The hyperglycosylation that tends to occur with Saccharomyces cerevisiae is much less a problem with P. pastoris [7], and the expressed proteins can either be kept inside the cells or be secreted into the culture medium. For secreted proteins, the purification process is expected to be simpler than that inside cells, since a reasonably high purity could be achieved in the supernatants. The amount of protein produced is usually in the range of 30% - 80% of all the secreted proteins [8,9]. Since the ability to attain very high cell densities (150 - 400 g wet cell/L can be reached in defined media [9,10]) by fermentative growth using bioreactors allows for high volumetric productivity, P. pastoris has become a robust system for the production of recombinant proteins.
Trastuzumab, an antibody directed against the human Her II protein produced by CHO, has been clinically used for the treatment and diagnosis of breast cancer [11]. However, the production costs are high, and alternative systems have been desired.
In this paper, we describe the construction of a P. pastoris strain capable of the extra-cellular expression of trastuzumab, its production in a flask culture, and results on the comparative characterization of the secretory product with a commercially available trastuzumab produced by CHO.
2. MATERIALS AND METHODS
2.1. Antibodies, Bacterial and Yeast Strains, and a Plasmid
Herceptin (trastuzumab produced by CHO) and Retuxin (rituximab produced by CHO) were purchased from Roche (USA).
Other antibodies used in immunoassays were from R&D Sciences (USA) and Life Span Biosciences (USA).
JM 109 competent cells used for plasmid construction were from Toyobo Biochemicals (Japan).
Picha pastoris GS115 and pPICZ A for expression of the target genes were from Life Technologies (USA).
2.2. Genes for Trastuzumab Heavy (H) and Light (L) Chains
Genes for trastuzumab heavy (H) chain and light (L) chain amino acid sequences [11] as listed below, where codons were optimized for expression in P. pastoris, were designed, and synthesized by GenScript (USA).
Trastuzumab H chain 451 amino acids;
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Trastuzumab L chain 214 amino acids;
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Both sequences were N-terminally fused to a secretion signal peptide sequence of egg white lysozyme for secretion by P. pastoris.
2.3. Construction of Plasmids
The H and L chain genes synthesized were inserted between the AOX 1 promoter and AOX 1 transcriptional terminator in pPICZ A to construct an H chain and an L chain expression vector, respectively. The DNA fragment that contained the AOX 1 promoter, L chain gene and AOX 1 transcription terminator, the L chain expression cassette, was cut out from the L chain expression vector with Bgl II and BamH I double digestion. The L chain expression cassette was then inserted into the BamH I site in the H chain expression vector to create an expression vector for trastuzumab. In order to improve the insertion of the whole H chain and L chain expression cassette into the host genome, a DNA fragment (approximately 450 bp) covering a 5’-upstream region of the AOX 1 promoter and N-terminal region of the Polyamine oxidase gene was amplified from the host genome by PCR using 5’CCTTTCGTCTTTGGATGTTAGATC3’ and 5’CTCACGTTAAGGGATTTTGGTCATGAGATCAgtagtttgcaagtacttataaacaaaattccg3’ (where the upper-case letters are the pPICZ A vector sequence and the lowercase letters are the ployamine oxidase gene sequence 349- 381 bp from its start codon) as primers, and sub-cloned into the Bgl II site, i.e. at the 5’-end of the AOX 1 promoter of the H chain expression cassette, in the antibody expression plasmid (see Figure 1 for details on the plasmids) using a PCR fragment cloning kit (In-Fusion HD EcoDry Cloning Kit, Takara , Japan).
2.4. Transformation of P. pastoris
The trastuzumab expression vector was linearized by Bgl II digestion. P. pastoris cells were transformed by electroporation according to the manual provided by Life Technologies. Transformants that appeared on YEPG (1% yeast extract, 2% peptone, 1 M sorbitol, 2% agar and 2% glucose) plates containing 100 mg/L Zeocin (Life Technologies) were checked for integrated DNA fragments by PCR using as primers,
Figure 1. Construction of the expression plasmid for trastuzumab: AOX I P: the Alcohol oxidase 1 promoter region. AOX I T: the Alcohol oxidase 1 transcriptional terminator region. Zeo: Zeocin resistance gene. Ori: plasmid replication origin. AOX I upstream fragment: a DNA fragment amplified by PCR that covers a region upstream of the AOX 1 promoter and a 5’ portion of the Polyamine oxidase gene.
5’GACTGGTTCCAATTGACAAGC3’ and 5’GCAAATGGCATTCTGACATCC3’, located in the AOX 1 promoter and AOX 1 transcriptional terminator, respectively.
2.5. Production of Trastuzumab
P. pastoris conaining the trastuzumab expression vector was cultured from in 10 mL of BMGY medium [1% yeast extract, 2% peptone, 1.34% yeast nitrogen base, 100 mM potassium phosphate (pH 6.0), 4 × 10–5% biotin, and 1% glycerol] overnight at 30˚C with shaking at 275 rpm. A 100-mL volume of BMGY medium was inoculated with 1 ml of the starting culture. The second culture was incubated for approximately 12 h at 30˚C with shaking at 275 rpm. Cells were harvested at an OD600nm of between 1 and 4 and pelleted by centrifugation for 10 min at 5000 rpm at 4˚C. Induction of protein expression was initiated by resuspending the yeast cells in 100 mL of BMMY medium [1% yeast extract, 2% peptone, 1.34% yeast nitrogen base, 100 mM potassium phosphate (pH 6.0), 4 × 10−5 % biotin, and 1% methanol]. Incubation was continued at 30˚C with shaking at 300 rpm for 24 h. A supplemental volume of methanol equal to 1/100 of the culture volume was added at 16 h. Following induction for 24 h, the culture was chilled on ice, and the cells and culture medium were separated by centrifugation for 10 min at 5000 rpm at 4˚C. The culture medium was stored at 4˚C.
2.6. Purification of Trastuzumab from Culture Media
Trastuzumab was recovered from the culture medium with an AKTA explorer 100A (GE Healthcare, NJ) using Streamline rProtein A (GE Healthcare, NJ). The rProtein A resin was equilibrated, and washed with 20 mM TrisHCl pH 7.0. The culture supernatant was loaded at a maximum capacity of 32 mg/mL resin at a residence time in excess of 6 min. Trastuzumab was eluted using a pH gradient from 4.0 to 3.0 in 100 mM sodium citrate. Eluate fractions were adjusted to pH 5.0 with 1 M Na2HPO4, before being diluted five-fold with H2O. The pH was then re-adjusted to 4.5 with 1 M acetic acid before being loaded on a Source 30S (GE Healthcare, NJ) column equilibrated with 25 mM sodium acetate, pH 4.5. Trastuzumab was eluted using the following stepwise elution protocol: 2 column volumes of Buffer A (12.5 mM sodium acetate, 12.5 mM sodium phosphate, pH 6.0), 2 column volumes of 4% Buffer B (12.5 mM sodium acetate, 12.5 mM sodium phosphate, 0.5 M sodium chloride, pH 6.0), 3 column volumes of 6% Buffer B, 15 column volumes of 8% Buffer B, 3 column volumes of 12% Buffer B, and 2 column volumes of 100% Buffer B.
2.7. N-glycosidase Treatment
Peptide-N4-(N-acetyl-β-glucosaminyl)-asparagine amidase was purchased from Takara (Japan). The samples were treated with the enzyme according to the manufacturer’s directions.
2.8. Elisa
Assays were conducted essentially as described [12]. Aliquots (100 μl) of antigen solution (3 mg/mL in PBS) were added to wells of an ELISA plate (COSTAR 9018), and incubated at 4˚C overnight. The plate was washed 3 times with PBS. The wells were blocked with 1% BSA in PBS at 37˚C for 2 hrs. The plate was washed 3 times with 0.05% Tween 20 in PBS. Samples (100 μL) were put into the wells, and incubated for 1 hr at room temperature. The plate was again washed 3 times with 0.05% Tween 20 in PBS. Next, 100 μL of 10–4 diluted anti-human L kappa goat antibody conjugated with HRP (Life Span Biosciences, USA) was put into the wells and incubated for 1 hr at room temperature. The plate was again washed 3 times with 0.05% Tween 20 in PBS. Detection of bound antibodies was done by measuring absorbance at 450 nm using 1.2-Phenylenediamine in Citrate buffer containing H2O2 [13].
2.9. Surface Plasmon Resonance
CHO-derived and Pichia-derived trastuzumabs’ affinity to Her II was measured with Biacore 3000 (GE Healthcare, NJ, USA). The assay was done in HBST (20 mM Hepes, pH 7.4, 150 mM NaCl and 0.05% Tween 20). Her II-Fc chimera (R&D Systems) was immobilized on a CM5 chip (GE Healthcare, NJ). The antibody was injected at the concentration between 1.56 nM and 50 nM. The off rate was calculated by monitoring the assay for at least 2 min. The data obtained were analyzed with global fitting using BIA evaluation soft (GE Healthcare).
3. RESULTS AND DISCUSSION
3.1. Construction of Expression Plasmids for Trastuzumab
A plasmid containing the antibody heavy chain and light chain secretory expression units under the control of the AOX 1 promoter was constructed (Figure 1). To increase the efficiency of integration of the vector into the host AOX 1 promoter region by homologous recombination, digestion at a unique site in the AOX 1 promoter region to linearize the original vector is recommended by the manufacturer. However, since the antibody expression plasmid contained two AOX 1 promoters, linearization of the expression vector with a restriction enzyme that cuts inside the AOX 1 promoter would separate the H chain and the light chain expression cassettes. A DNA fragment of the upstream region of the AOX 1 gene promoter and a part of the flanking gene, Polyamine oxidase, was amplified from the genome by PCR, and then put into the Bgl II site, i.e. at the 5’-end of the AOX 1 promoter of the H chain expression cassette. Linearization of the plasmid with Bgl II digestion would be expected to facilitate integration of the entire antibody expression construct through homologous recombination between the host genome and the plasmid in the region surrounding the Bgl II site.
3.2. Isolation of Transformants, and Checking of the Antibody Expression Construct
Using the transformation conditions recommended by the manufacturer, only three colonies appeared on plates containing Zeocin (100 mg/mL), despite that the original vector, pPICZ A, could transform hundreds of colonies under the same conditions. It is thought that the expression of the antibody might be harmful to the cells. Genomic DNA of these three colonies was isolated, and checked for the insertion of the expression construct by PCR. Two of them showed integration of the construct. One was selected for further cultivation and production.
3.3. Secretion of Trastuzumab, and Its Characterization
After cultivation and induction of the transformant selected, the culture medium was separated from the cells by centrifugation. The production of the antibody in the culture medium was checked by western blotting using anti-human IgG Fc and anti-human κ (Figure 2 (a)). The heavy chain produced by P. pastoris was detected as two bands. The main was at a slightly higher molecular weight position than the one produced by CHO, but the weaker band was seen at the same position. The light chain was detected as one band almost at the same position as that produced by CHO. The antibody in the culture medium was then affinity-purified with a Protein A column, and the product was analyzed by SDS-PAGE under reduced and non-reduced conditions. Under nonreduced conditions, the molecular weight of the antibody was approximately 250 kDa, and almost the same as that produced by CHO (Figure 2 (b)). The antibody is considered to be correctly assembled to form a heterotetramer. The light chain and heavy chain bands were separated by SDS-PAGE, and transferred to a membrane filter to analyze their N-terminal amino acid sequences with a sequencer. The N-terminal sequences of the heavy chain and light chain were revealed to be EVQLVand DIQMT-, respectively. These results were consistent with the amino acid sequences predicted from the DNA. The chicken lysozyme signal peptide of both chains was precisely processed in P. pasotris.
(a) (b)
Figure 2. Western blotting and SDS-PAGE of trastuzumab secreted in the Pichia pastoris culture medium. (a) Left panel; western blotting with anti-human IgG Fc. H indicates the antibody’s heavy chain. Right panel; western blotting with anti-human light chain kappa. L indicates the antibody’s light chain. Lane M; molecular weight markers. Lane 1; trastuzumab produced by CHO. Lane 2; trastuzumab produced by P. pastoris; (b) Lanes 1 and 2; A Coomassiee blue-stained SDSPAGE gel under reduced conditions. Lanes 3 and 4; A Coomassie blue-stained SDS-PAGE gel under non-reduced conditions. H, L and W indicate the H chain, L chain and hetero-tetramer, respectively. Lane M; molecular weight markers. Lanes 1 and 3; trastuzumab produced by CHO. Lanes 2 and 4; rProtein A-captured trastuzumab produced by Pichia pastoris.
3.4. Analysis of Sugar Chains
The antibody was further purified with an ion exchange column, Resource S (GE Healthcare Japan), and treated with Peptide-N4-(N-acetyl-β-glucosaminyl)-asparagine amidase. The samples were analyzed by SDS-PAGE (Figure 3). After treatment with the enzyme, the heavy chain showed a decrease in molecular weight and the same mobility as the one produced by CHO (Figure 3). From this result, the heavy chain produced by P. pastoris has major sugar chains linked to asparagine as is the case with that produced by CHO. The sugar chains removed from the heavy chain produced by P. pastris were further analyzed with MALDI-TOF mass spectroscopy. Figure 4 shows the mass spectra. From the peaks in the spectra, the sugar chain structures were estimated to be Man9- GlcNAc2 (Mw: 1962), Man10-GlcNAc2 (Mw: 2124), Man11-GlcNAc2 (Mw: 2286) and Man12-GlcNAc2 (Mw: 2448). They were all high-mannose type sugars, however, there were no hyper mannosylated or fucosylated sugar chains detected. Hyper-mannosylated sugar chains are typical of yeast proteins, and thought to be immunogenic for human [14-16]. However, high-mannose type sugar chains are frequently observed in human sugar chains. Fucosylation of the sugar chains of antibodies, usually observed in the CHO product, was reported to have an, adverse effect on effector functions [17,18]. The antibody produced by P. pastoris could be expected to have higher ADCC (antibody-dependent cell mediated cytotoxicity) than the one produced by CHO.
3.5. Affinity for Human Her II
Binding to Her II was compared between the antibody produced by P. pastris and that produced by CHO using ELISA and Surface Plasmon Resonance. The affinity curves and constants were almost the same (Figure 5 and
Figure 3. Trastuzumab treated with Peptide-N4-(N-acetyl-β- glucosaminyl)-asparagine amidase. Samples were analyzed by SDS-PAGE under reduced conditions. Lane M; molecular weight markers (kDa). Lane 1; Peptide-N4-(N-acetyl-β- glucosaminyl)-asparagine amidase. Lanes 2 and 3; trastuzumab produced by CHO. Lanes 4 and 5; trastuzumab produced by P. pastoris. Lanes 2 and 4; trastuzumab without Peptide-N4-(N-acetyl-β-glucosaminyl)-asparagine amidase treatment. Lanes 3 and 5; trastuzumab with Peptide-N4-(N-acetyl-β- glucosaminyl)-asparagine amidase treatment. L indicates the L chain. H indicates the H chain without N-linked glycans and GH indicates the H chain with N-linked glycans. The gel was stained with Coomassiee blue.
Figure 4. MALDI-TOF mass spectra of N-linked glycans attached to trastuzumab produced by P. pastoris. Each N-glycan has two peaks, one with an H ion and another with an Na ion. Structures deduced from peaks 1, 2, 3 and 4 are Man9GlcNAc2 (Mw: 1962), Man10GlcNAc2 (Mw: 2124), Man11GlcNAc2 (Mw: 2286) and Man12GlcNAc2 (Mw: 2448), respectively.
Figure 5. Comparison of reactivity to the antigen with the CHO product. Assays were carried out with ELISA as described in materials and methods. ▲: Rituximab (an antibody to CD20, a negative control). ●: trastuzumab produced by CHO. ■: trastuzumab produced by P. pastris.
Table 1). Reactivity to the breast cancer cell line SK-R-3 overexpressing Her II was also compared using flow cytometry (Figure 6). The reaction pattern was very similar, whereas rituximab did not show any bindings to the cell line.